PDB entry 1dxx

View 1dxx on RCSB PDB site
Description: n-terminal actin-binding domain of human dystrophin
Class: structural protein
Keywords: structural protein, dystrophin, muscular dystrophy, calponin homology domain, actin-binding, utrophin
Deposited on 2000-01-20, released 2000-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dystrophin
    Species: Homo sapiens [TaxId:9606]
    Gene: DMD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11532 (Start-245)
      • engineered (9)
      • engineered (187)
    Domains in SCOPe 2.07: d1dxxa1, d1dxxa2
  • Chain 'B':
    Compound: dystrophin
    Species: Homo sapiens [TaxId:9606]
    Gene: DMD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11532 (Start-245)
      • engineered (9)
      • engineered (187)
    Domains in SCOPe 2.07: d1dxxb1, d1dxxb2
  • Chain 'C':
    Compound: dystrophin
    Species: Homo sapiens [TaxId:9606]
    Gene: DMD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11532 (Start-245)
      • engineered (9)
      • engineered (187)
    Domains in SCOPe 2.07: d1dxxc1, d1dxxc2
  • Chain 'D':
    Compound: dystrophin
    Species: Homo sapiens [TaxId:9606]
    Gene: DMD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11532 (Start-245)
      • engineered (9)
      • engineered (187)
    Domains in SCOPe 2.07: d1dxxd1, d1dxxd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxxA (A:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxA (A:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dxxB (B:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxB (B:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dxxC (C:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxC (C:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dxxD (D:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxD (D:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie