Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (15 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188759] (2 PDB entries) |
Domain d3dg8d_: 3dg8 D: [173919] Other proteins in same PDB: d3dg8a_, d3dg8b_ automated match to d1j3ic_ complexed with ndp, rj6, ump; mutant |
PDB Entry: 3dg8 (more details), 2.58 Å
SCOPe Domain Sequences for d3dg8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dg8d_ d.117.1.1 (D:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} ddeeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngnkq sdrtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnknvr iweangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlkniinl ikndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpfni asysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdikn iedftisdftiqnyvhhekismdmaa
Timeline for d3dg8d_: