SCOPe 2.06: Domain d3dg8c_: 3dg8 C:

Lineage for d3dg8c_ (3dg8 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (15 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188759] (2 PDB entries)

8. Domain d3dg8c_: 3dg8 C: [173918]
   Other proteins in same PDB: d3dg8a_, d3dg8b_
   automated match to d1j3ic_
   complexed with ndp, rj6, ump; mutant

Details for d3dg8c_

PDB Entry: 3dg8, 2.58 Å

PDB Description: quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with rjf670, nadph, and dump

PDB Compounds: (C:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3dg8c_:

Sequence; same for both SEQRES and ATOM records:

>d3dg8c_ d.117.1.1 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ddeeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngnkq
sdrtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnknvr
iweangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlkniinl
ikndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpfni
asysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdikn
iedftisdftiqnyvhhekismdmaa

Timeline for d3dg8c_:

• d3dg8c_ first appeared in SCOPe 2.01
  
• d3dg8c_ appears in SCOPe 2.05
  
• d3dg8c_ appears in SCOPe 2.07
  
• d3dg8c_ appears in the current release, SCOPe 2.08