SCOPe 2.01: Domain d3dg8d_: 3dg8 D:

Lineage for d3dg8d_ (3dg8 D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (5 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188759] (2 PDB entries)

8. Domain d3dg8d_: 3dg8 D: [173919]
   automated match to d1j3ic_
   complexed with ndp, rj6, ump; mutant

Details for d3dg8d_

PDB Entry: 3dg8, 2.58 Å

PDB Description: quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with rjf670, nadph, and dump

PDB Compounds: (D:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3dg8d_:

Sequence; same for both SEQRES and ATOM records:

>d3dg8d_ d.117.1.1 (D:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ddeeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngnkq
sdrtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnknvr
iweangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlkniinl
ikndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpfni
asysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdikn
iedftisdftiqnyvhhekismdmaa

Timeline for d3dg8d_:

• d3dg8d_ is new in SCOPe 2.01-stable
  
• d3dg8d_ appears in SCOPe 2.02
  
• d3dg8d_ appears in the current release, SCOPe 2.08