Lineage for d3dg8d_ (3dg8 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972660Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188759] (2 PDB entries)
  8. 2972662Domain d3dg8d_: 3dg8 D: [173919]
    Other proteins in same PDB: d3dg8a_, d3dg8b_
    automated match to d1j3ic_
    complexed with ndp, rj6, ump; mutant

Details for d3dg8d_

PDB Entry: 3dg8 (more details), 2.58 Å

PDB Description: quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with rjf670, nadph, and dump
PDB Compounds: (D:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3dg8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dg8d_ d.117.1.1 (D:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ddeeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngnkq
sdrtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnknvr
iweangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlkniinl
ikndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpfni
asysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdikn
iedftisdftiqnyvhhekismdmaa

SCOPe Domain Coordinates for d3dg8d_:

Click to download the PDB-style file with coordinates for d3dg8d_.
(The format of our PDB-style files is described here.)

Timeline for d3dg8d_: