SCOPe 2.08: Domain d1b7tz_: 1b7t Z:

Lineage for d1b7tz_ (1b7t Z:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries)
   Uniprot P07291

8. Domain d1b7tz_: 1b7t Z: [17318]
   Other proteins in same PDB: d1b7ta1, d1b7ta4, d1b7ty_
   complexed with adp, ca, mg

Details for d1b7tz_

PDB Entry: 1b7t, 2.5 Å

PDB Description: myosin digested by papain

PDB Compounds: (Z:) myosin essential light chain

SCOPe Domain Sequences for d1b7tz_:

Sequence; same for both SEQRES and ATOM records:

>d1b7tz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
vdeiikltdlqedlegnvkyedfvkkvmagpyp

Timeline for d1b7tz_:

• d1b7tz_ first appeared (with stable ids) in SCOP 1.55
  
• d1b7tz_ appears in SCOPe 2.07