SCOPe 2.08: Domain d1b7ta1: 1b7t A:29-76

Lineage for d1b7ta1 (1b7t A:29-76)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
   Uniprot P24733 3-836 ! Uniprot P24733 6-837

8. Domain d1b7ta1: 1b7t A:29-76 [24572]
   Other proteins in same PDB: d1b7ta4, d1b7ty_, d1b7tz_
   complexed with adp, ca, mg

Details for d1b7ta1

PDB Entry: 1b7t, 2.5 Å

PDB Description: myosin digested by papain

PDB Compounds: (A:) myosin heavy chain

SCOPe Domain Sequences for d1b7ta1:

Sequence; same for both SEQRES and ATOM records:

>d1b7ta1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

Timeline for d1b7ta1:

• d1b7ta1 first appeared (with stable ids) in SCOP 1.55
  
• d1b7ta1 appears in SCOPe 2.07