Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188452] (13 PDB entries) |
Domain d3bx8h_: 3bx8 H: [172902] automated match to d1ngla_ complexed with 1pe, pe5 |
PDB Entry: 3bx8 (more details), 2 Å
SCOPe Domain Sequences for d3bx8h_:
Sequence, based on SEQRES records: (download)
>d3bx8h_ b.60.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sdlipapplskvplqqnfqdnqfhgkwyvvglagnrilrddqhpmnmyatiyelkedksy nvtsvisshkkceytiatfvpgsqpgeftlgniksygdktsylvrvvstdynqyavvffk laednaeffaitiygrtkelaselkenfirfskslglpenhivfpvpidqcid
>d3bx8h_ b.60.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sdlipapplskvplqqfqdnqfhgkwyvvglagnrilrddqhpmnmyatiyelkedksyn vtsvisshkkceytiatfvpgsqpgeftlgtsylvrvvstdynqyavvffklaeeffait iygrtkelaselkenfirfskslglpenhivfpvpidqcid
Timeline for d3bx8h_: