Lineage for d1ngla_ (1ngl A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1551838Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 1551839Species Human (Homo sapiens) [TaxId:9606] [50836] (28 PDB entries)
  8. 1551915Domain d1ngla_: 1ngl A: [27146]

Details for d1ngla_

PDB Entry: 1ngl (more details)

PDB Description: human neutrophil gelatinase-associated lipocalin (hngal), regularised average nmr structure
PDB Compounds: (A:) protein (ngal)

SCOPe Domain Sequences for d1ngla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngla_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
mqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelk
edksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqha
mvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

SCOPe Domain Coordinates for d1ngla_:

Click to download the PDB-style file with coordinates for d1ngla_.
(The format of our PDB-style files is described here.)

Timeline for d1ngla_: