Lineage for d1ngla_ (1ngl A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50836] (3 PDB entries) 
Domain d1ngla_: 1ngl A: [27146]
Details for d1ngla_
PDB Entry: 1ngl (more details)
PDB Description: human neutrophil gelatinase-associated lipocalin (hngal), regularised average nmr structure
SCOP Domain Sequences for d1ngla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngla_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens)}
mqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelk
edksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqha
mvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
SCOP Domain Coordinates for d1ngla_:
Click to download the PDB-style file with coordinates for d1ngla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ngla_:
- d1ngla_ appears in SCOP 1.57
- d1ngla_ appears in the current release, SCOPe 2.08, called d1ngla1
View in 3D