Lineage for d1ngla1 (1ngl A:2-179)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries)
  8. Domain d1ngla1: 1ngl A:2-179 [27146]
    Other proteins in same PDB: d1ngla2

Details for d1ngla1

PDB Entry: 1ngl (more details)

PDB Description: human neutrophil gelatinase-associated lipocalin (hngal), regularised average nmr structure
PDB Compounds: (A:) protein (ngal)

SCOPe Domain Sequences for d1ngla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngla1 b.60.1.1 (A:2-179) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
dksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqham
vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

SCOPe Domain Coordinates for d1ngla1 are not available.

Timeline for d1ngla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngla2