Lineage for d3bx8h_ (3bx8 H:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324586Protein automated matches [190163] (12 species)
    not a true protein
  7. 1324606Species Human (Homo sapiens) [TaxId:9606] [188452] (10 PDB entries)
  8. 1324622Domain d3bx8h_: 3bx8 H: [172902]
    automated match to d1ngla_
    complexed with 1pe, pe5

Details for d3bx8h_

PDB Entry: 3bx8 (more details), 2 Å

PDB Description: Engineered Human Lipocalin 2 (LCN2), apo-form
PDB Compounds: (H:) engineered human lipocalin 2

SCOPe Domain Sequences for d3bx8h_:

Sequence, based on SEQRES records: (download)

>d3bx8h_ b.60.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfhgkwyvvglagnrilrddqhpmnmyatiyelkedksy
nvtsvisshkkceytiatfvpgsqpgeftlgniksygdktsylvrvvstdynqyavvffk
laednaeffaitiygrtkelaselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records): (download)

>d3bx8h_ b.60.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqfqdnqfhgkwyvvglagnrilrddqhpmnmyatiyelkedksyn
vtsvisshkkceytiatfvpgsqpgeftlgtsylvrvvstdynqyavvffklaeeffait
iygrtkelaselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d3bx8h_:

Click to download the PDB-style file with coordinates for d3bx8h_.
(The format of our PDB-style files is described here.)

Timeline for d3bx8h_: