Lineage for d3bx8b_ (3bx8 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1552080Protein automated matches [190163] (13 species)
    not a true protein
  7. 1552108Species Human (Homo sapiens) [TaxId:9606] [188452] (13 PDB entries)
  8. 1552118Domain d3bx8b_: 3bx8 B: [172896]
    automated match to d1ngla_
    complexed with 1pe, pe5

Details for d3bx8b_

PDB Entry: 3bx8 (more details), 2 Å

PDB Description: Engineered Human Lipocalin 2 (LCN2), apo-form
PDB Compounds: (B:) engineered human lipocalin 2

SCOPe Domain Sequences for d3bx8b_:

Sequence, based on SEQRES records: (download)

>d3bx8b_ b.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfhgkwyvvglagnrilrddqhpmnmyatiyelkedks
ynvtsvisshkkceytiatfvpgsqpgeftlgniksygdktsylvrvvstdynqyavvff
klaednaeffaitiygrtkelaselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records): (download)

>d3bx8b_ b.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfhgkwyvvglagnrilrddqhpmnmyatiyelkedks
ynvtsvisshkkceytiatfvpgsqpgeftlgntsylvrvvstdynqyavvffkladnae
ffaitiygrtkelaselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d3bx8b_:

Click to download the PDB-style file with coordinates for d3bx8b_.
(The format of our PDB-style files is described here.)

Timeline for d3bx8b_: