Lineage for d3bwkc_ (3bwk C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926957Protein automated matches [190264] (12 species)
    not a true protein
  7. 2926999Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188686] (2 PDB entries)
  8. 2927002Domain d3bwkc_: 3bwk C: [172886]
    automated match to d1yvba1
    complexed with c1p, so4

Details for d3bwkc_

PDB Entry: 3bwk (more details), 2.42 Å

PDB Description: Crystal Structure of Falcipain-3 with Its inhibitor, K11017
PDB Compounds: (C:) Cysteine protease falcipain-3

SCOPe Domain Sequences for d3bwkc_:

Sequence, based on SEQRES records: (download)

>d3bwkc_ d.3.1.1 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
yeanyedvikkykpadakldriaydwrlhggvtpvkdqalcgscwafssvgsvesqyair
kkalflfseqelvdcsvknngcyggyitnafddmidlgglcsqddypyvsnlpetcnlkr
cnerytiksyvsipddkfkealrylgpisisiaasddfafyrggfydgecgaapnhavil
vgygmkdiynedtgrmekfyyyiiknswgsdwgeggyinletdengykktcsigteayvp
ll

Sequence, based on observed residues (ATOM records): (download)

>d3bwkc_ d.3.1.1 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
yeanyedvikkykpadakldriaydwrlhggvtpvkdqalcgscwafssvgsvesqyair
kkalflfseqelvdcsvknngcyggyitnafddmidlgglcsqddypyvsnlpetcnlkr
cnerytiksyvsipddkfkealrylgpisisiaasddfafyrggfydgecgaapnhavil
vgygmkdiekfyyyiiknswgsdwgeggyinletdengykktcsigteayvpll

SCOPe Domain Coordinates for d3bwkc_:

Click to download the PDB-style file with coordinates for d3bwkc_.
(The format of our PDB-style files is described here.)

Timeline for d3bwkc_: