Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein automated matches [190264] (12 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188686] (2 PDB entries) |
Domain d3bwkb_: 3bwk B: [172885] automated match to d1yvba1 complexed with c1p, so4 |
PDB Entry: 3bwk (more details), 2.42 Å
SCOPe Domain Sequences for d3bwkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bwkb_ d.3.1.1 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} yeanyedvikkykpadakldriaydwrlhggvtpvkdqalcgscwafssvgsvesqyair kkalflfseqelvdcsvknngcyggyitnafddmidlgglcsqddypyvsnlpetcnlkr cnerytiksyvsipddkfkealrylgpisisiaasddfafyrggfydgecgaapnhavil vgygmkdiynedtgrmekfyyyiiknswgsdwgeggyinletdengykktcsigteayvp ll
Timeline for d3bwkb_: