Lineage for d1yvba1 (1yvb A:0-212)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926873Protein Falcipain 2 [142846] (1 species)
  7. 2926874Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142847] (5 PDB entries)
    Uniprot Q9N6S8 244-484
  8. 2926877Domain d1yvba1: 1yvb A:0-212 [124092]
    Other proteins in same PDB: d1yvbi_
    complexed with gol

Details for d1yvba1

PDB Entry: 1yvb (more details), 2.7 Å

PDB Description: the plasmodium falciparum cysteine protease falcipain-2
PDB Compounds: (A:) falcipain 2

SCOPe Domain Sequences for d1yvba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvba1 d.3.1.1 (A:0-212) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e

SCOPe Domain Coordinates for d1yvba1:

Click to download the PDB-style file with coordinates for d1yvba1.
(The format of our PDB-style files is described here.)

Timeline for d1yvba1: