![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries) |
![]() | Domain d3bved1: 3bve D:1-166 [172842] Other proteins in same PDB: d3bvea2, d3bveb2, d3bvec2, d3bved2, d3bvee2, d3bvef2 automated match to d1krqa_ complexed with gol |
PDB Entry: 3bve (more details), 1.8 Å
SCOPe Domain Sequences for d3bved1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bved1 a.25.1.1 (D:1-166) automated matches {Helicobacter pylori [TaxId: 210]} mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3bved1: