Lineage for d3bved_ (3bve D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911451Protein automated matches [190041] (18 species)
    not a true protein
  7. 911520Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. 911542Domain d3bved_: 3bve D: [172842]
    automated match to d1krqa_
    complexed with gol

Details for d3bved_

PDB Entry: 3bve (more details), 1.8 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d3bved_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bved_ a.25.1.1 (D:) automated matches {Helicobacter pylori [TaxId: 210]}
hhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeh
akkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskd
hatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d3bved_:

Click to download the PDB-style file with coordinates for d3bved_.
(The format of our PDB-style files is described here.)

Timeline for d3bved_: