Lineage for d3bveb1 (3bve B:1-166)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702486Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. 2702506Domain d3bveb1: 3bve B:1-166 [172840]
    Other proteins in same PDB: d3bvea2, d3bveb2, d3bvec2, d3bved2, d3bvee2, d3bvef2
    automated match to d1krqa_
    complexed with gol

Details for d3bveb1

PDB Entry: 3bve (more details), 1.8 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d3bveb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bveb1 a.25.1.1 (B:1-166) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d3bveb1:

Click to download the PDB-style file with coordinates for d3bveb1.
(The format of our PDB-style files is described here.)

Timeline for d3bveb1: