Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcium vector protein [47514] (1 species) |
Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [47515] (4 PDB entries) |
Domain d1c7wa_: 1c7w A: [17261] C-terminal domain (w81-s161) fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1c7w (more details)
SCOPe Domain Sequences for d1c7wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7wa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} eeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgngvidipe fmdlikks
Timeline for d1c7wa_: