Lineage for d1c7wa_ (1c7w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710572Protein Calcium vector protein [47514] (1 species)
  7. 2710573Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [47515] (4 PDB entries)
  8. 2710574Domain d1c7wa_: 1c7w A: [17261]
    C-terminal domain (w81-s161)
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1c7wa_

PDB Entry: 1c7w (more details)

PDB Description: nmr solution structure of the calcium-bound c-terminal domain (w81- s161) of calcium vector protein from amphioxus
PDB Compounds: (A:) calcium vector protein

SCOPe Domain Sequences for d1c7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7wa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
eeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgngvidipe
fmdlikks

SCOPe Domain Coordinates for d1c7wa_:

Click to download the PDB-style file with coordinates for d1c7wa_.
(The format of our PDB-style files is described here.)

Timeline for d1c7wa_: