PDB entry 1c7w

View 1c7w on RCSB PDB site
Description: nmr solution structure of the calcium-bound c-terminal domain (w81-s161) of calcium vector protein from amphioxus
Class: metal binding protein
Keywords: ef-hand family, calcium binding protein, nmr, metal binding protein
Deposited on 2000-03-27, released 2000-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcium vector protein
  Species: Branchiostoma lanceolatum [TaxId:7740]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04573
  Domains in SCOPe 2.08: d1c7wa_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1c7wA (A:)
  wvrqddeeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgng
  vidipefmdlikksknalkes
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1c7wA (A:)
  eeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgngvidipe
  fmdlikks