Lineage for d2scpb_ (2scp B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. Protein Sarcoplasmic calcium-binding protein [47509] (2 species)
  7. Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (2 PDB entries)
    Uniprot P04571
  8. Domain d2scpb_: 2scp B: [17257]
    complexed with ca

Details for d2scpb_

PDB Entry: 2scp (more details), 2 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution
PDB Compounds: (B:) Sarcoplasmic calcium-binding protein

SCOPe Domain Sequences for d2scpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scpb_ a.39.1.5 (B:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}
sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv

SCOPe Domain Coordinates for d2scpb_ are not available.

Timeline for d2scpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2scpa_