Lineage for d2scpb_ (2scp B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Sarcoplasmic calcium-binding protein [47509] (2 species) Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (1 PDB entry) 
Domain d2scpb_: 2scp B: [17257]
Details for d2scpb_
PDB Entry: 2scp (more details), 2 Å
PDB Description: structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution
SCOP Domain Sequences for d2scpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2scpb_ a.39.1.5 (B:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor)}
sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv
SCOP Domain Coordinates for d2scpb_:
Click to download the PDB-style file with coordinates for d2scpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2scpb_:
- d2scpb_ appears in SCOP 1.57
- d2scpb_ appears in the current release, SCOPe 2.08
View in 3D
