SCOPe 2.08: Domain d3b83a1: 3b83 A:0-89

Lineage for d3b83a1 (3b83 A:0-89)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d3b83a1: 3b83 A:0-89 [172478]
   Other proteins in same PDB: d3b83a2, d3b83b2, d3b83c2, d3b83d2, d3b83e2, d3b83f2, d3b83g2, d3b83h2
   automated match to d1tena_

Details for d3b83a1

PDB Entry: 3b83, 2.4 Å

PDB Description: Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.

PDB Compounds: (A:) ten-d3

SCOPe Domain Sequences for d3b83a1:

Sequence; same for both SEQRES and ATOM records:

>d3b83a1 b.1.2.0 (A:0-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
nlepnttyeirivarngqqysppvsttftt

Timeline for d3b83a1:

• d3b83a1 first appeared in SCOPe 2.01, called d3b83a_
  
• d3b83a1 appears in SCOPe 2.07