Lineage for d3b83h1 (3b83 H:0-89)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762307Domain d3b83h1: 3b83 H:0-89 [172485]
    Other proteins in same PDB: d3b83a2, d3b83b2, d3b83c2, d3b83d2, d3b83e2, d3b83f2, d3b83g2, d3b83h2
    automated match to d1tena_

Details for d3b83h1

PDB Entry: 3b83 (more details), 2.4 Å

PDB Description: Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.
PDB Compounds: (H:) ten-d3

SCOPe Domain Sequences for d3b83h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b83h1 b.1.2.0 (H:0-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
nlepnttyeirivarngqqysppvsttftt

SCOPe Domain Coordinates for d3b83h1:

Click to download the PDB-style file with coordinates for d3b83h1.
(The format of our PDB-style files is described here.)

Timeline for d3b83h1: