| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
| Protein automated matches [190976] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
| Domain d3b83h1: 3b83 H:0-89 [172485] Other proteins in same PDB: d3b83a2, d3b83b2, d3b83c2, d3b83d2, d3b83e2, d3b83f2, d3b83g2, d3b83h2 automated match to d1tena_ |
PDB Entry: 3b83 (more details), 2.4 Å
SCOPe Domain Sequences for d3b83h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b83h1 b.1.2.0 (H:0-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
nlepnttyeirivarngqqysppvsttftt
Timeline for d3b83h1: