PDB entry 3b83

View 3b83 on RCSB PDB site
Description: Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.
Class: unknown function
Keywords: beta sheet, computational redesigned protein, Cell adhesion, EGF-like domain, Extracellular matrix, Glycoprotein, Phosphorylation, Secreted, UNKNOWN FUNCTION
Deposited on 2007-10-31, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.24
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83 (0-End)
    Domains in SCOPe 2.07: d3b83a1, d3b83a2
  • Chain 'B':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83
    Domains in SCOPe 2.07: d3b83b1, d3b83b2
  • Chain 'C':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83 (0-End)
    Domains in SCOPe 2.07: d3b83c1, d3b83c2
  • Chain 'D':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83
    Domains in SCOPe 2.07: d3b83d1, d3b83d2
  • Chain 'E':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83 (0-End)
    Domains in SCOPe 2.07: d3b83e1, d3b83e2
  • Chain 'F':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83
    Domains in SCOPe 2.07: d3b83f1, d3b83f2
  • Chain 'G':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83 (0-End)
    Domains in SCOPe 2.07: d3b83g1, d3b83g2
  • Chain 'H':
    Compound: ten-d3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B83 (0-End)
    Domains in SCOPe 2.07: d3b83h1, d3b83h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b83A (A:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83A (A:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgsleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b83B (B:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83B (B:)
    lqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltltn
    lepnttyeirivarngqqysppvsttfttgsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b83C (C:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83C (C:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b83D (D:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83D (D:)
    lqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltltn
    lepnttyeirivarngqqysppvsttfttgs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3b83E (E:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83E (E:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3b83F (F:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83F (F:)
    lqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltltn
    lepnttyeirivarngqqysppvsttfttgsl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3b83G (G:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83G (G:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3b83H (H:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b83H (H:)
    mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
    nlepnttyeirivarngqqysppvsttfttgsle