| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Tenascin [49273] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49275] (1 PDB entry) |
| Domain d1tena_: 1ten A: [21990] third Fn3 repeat |
PDB Entry: 1ten (more details), 1.8 Å
SCOPe Domain Sequences for d1tena_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]}
rldapsqievkdvtdttalitwfkplaeidgieltygikdvpgdrttidltedenqysig
nlkpdteyevslisrrgdmssnpaketftt
Timeline for d1tena_: