SCOPe 2.08: Domain d3axyj_: 3axy J:

Lineage for d3axyj_ (3axy J:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (11 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [189745] (1 PDB entry)

8. Domain d3axyj_: 3axy J: [172376]
   automated match to d1o9ca_
   protein/DNA complex

Details for d3axyj_

PDB Entry: 3axy, 2.4 Å

PDB Description: Structure of Florigen Activation Complex Consisting of Rice Florigen Hd3a, 14-3-3 Protein GF14 and Rice FD Homolog OsFD1

PDB Compounds: (J:) 14-3-3-like protein GF14-C

SCOPe Domain Sequences for d3axyj_:

Sequence; same for both SEQRES and ATOM records:

>d3axyj_ a.118.7.1 (J:) automated matches {Oryza sativa [TaxId: 39947]}
sreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarrasw
rivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskvf
ylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsvf
yyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd

Timeline for d3axyj_:

• d3axyj_ first appeared in SCOPe 2.01
  
• d3axyj_ appears in SCOPe 2.07