![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.7: 14-3-3 protein [48445] (1 family) ![]() automatically mapped to Pfam PF00244 |
![]() | Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
![]() | Protein automated matches [190238] (11 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [189745] (1 PDB entry) |
![]() | Domain d3axyc_: 3axy C: [172373] automated match to d1o9ca_ protein/DNA complex |
PDB Entry: 3axy (more details), 2.4 Å
SCOPe Domain Sequences for d3axyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3axyc_ a.118.7.1 (C:) automated matches {Oryza sativa [TaxId: 39947]} msreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarras wrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskv fylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsv fyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
Timeline for d3axyc_: