PDB entry 3axy

View 3axy on RCSB PDB site
Description: Structure of Florigen Activation Complex Consisting of Rice Florigen Hd3a, 14-3-3 Protein GF14 and Rice FD Homolog OsFD1
Class: signaling protein/protein binding
Keywords: Phosphatidylethanolamine-binding Protein, 14-3-3 Protein, bZip protein, Floral Induction, Transcriptional Activator, Signaling Protein, DNA Binding, Phosphorylation, Nucleus, SIGNALING PROTEIN-PROTEIN BINDING complex
Deposited on 2011-04-19, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein HEADING DATE 3A
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: HD3A, LOC_Os06g06320, Os06g0157700, OsJ_20191, P0046E09.30, P0702F05.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93WI9 (5-169)
      • expression tag (4)
      • engineered mutation (42)
      • engineered mutation (108)
      • engineered mutation (165)
  • Chain 'B':
    Compound: Protein HEADING DATE 3A
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: HD3A, LOC_Os06g06320, Os06g0157700, OsJ_20191, P0046E09.30, P0702F05.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93WI9 (5-169)
      • expression tag (4)
      • engineered mutation (42)
      • engineered mutation (108)
      • engineered mutation (165)
  • Chain 'C':
    Compound: 14-3-3-like protein GF14-C
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: GF14C, LOC_Os08g33370, OJ1124_B05.7, Os08g0430500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3axyc_
  • Chain 'D':
    Compound: 14-3-3-like protein GF14-C
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: GF14C, LOC_Os08g33370, OJ1124_B05.7, Os08g0430500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3axyd_
  • Chain 'E':
    Compound: Rice FD homolog OsFD1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXY (Start-8)
  • Chain 'F':
    Compound: Rice FD homolog OsFD1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXY (Start-8)
  • Chain 'G':
    Compound: Protein HEADING DATE 3A
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: HD3A, LOC_Os06g06320, Os06g0157700, OsJ_20191, P0046E09.30, P0702F05.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93WI9 (5-End)
      • expression tag (4)
      • engineered mutation (42)
      • engineered mutation (108)
      • engineered mutation (165)
  • Chain 'H':
    Compound: Protein HEADING DATE 3A
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: HD3A, LOC_Os06g06320, Os06g0157700, OsJ_20191, P0046E09.30, P0702F05.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93WI9 (5-169)
      • expression tag (4)
      • engineered mutation (42)
      • engineered mutation (108)
      • engineered mutation (165)
  • Chain 'I':
    Compound: 14-3-3-like protein GF14-C
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: GF14C, LOC_Os08g33370, OJ1124_B05.7, Os08g0430500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3axyi_
  • Chain 'J':
    Compound: 14-3-3-like protein GF14-C
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: GF14C, LOC_Os08g33370, OJ1124_B05.7, Os08g0430500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3axyj_
  • Chain 'K':
    Compound: Rice FD homolog OsFD1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXY (Start-8)
  • Chain 'L':
    Compound: Rice FD homolog OsFD1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXY (Start-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3axyC (C:)
    gplgsmsreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvig
    arraswrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpssta
    aeskvfylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlgla
    lnfsvfyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axyC (C:)
    msreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarras
    wrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskv
    fylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsv
    fyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3axyD (D:)
    gplgsmsreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvig
    arraswrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpssta
    aeskvfylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlgla
    lnfsvfyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axyD (D:)
    msreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarras
    wrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskv
    fylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsv
    fyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3axyI (I:)
    gplgsmsreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvig
    arraswrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpssta
    aeskvfylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlgla
    lnfsvfyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axyI (I:)
    msreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarras
    wrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskv
    fylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsv
    fyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3axyJ (J:)
    gplgsmsreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvig
    arraswrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpssta
    aeskvfylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlgla
    lnfsvfyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axyJ (J:)
    sreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarrasw
    rivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskvf
    ylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsvf
    yyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.