SCOP 1.63: Domain d1avsb_: 1avs B:

Lineage for d1avsb_ (1avs B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (9 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (5 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (23 PDB entries)

8. Domain d1avsb_: 1avs B: [17227]
   calcium-saturated N-terminal domain
   complexed with ca

Details for d1avsb_

PDB Entry: 1avs, 1.75 Å

PDB Description: x-ray crystallographic study of calcium-saturated n-terminal domain of troponin c

SCOP Domain Sequences for d1avsb_:

Sequence; same for both SEQRES and ATOM records:

>d1avsb_ a.39.1.5 (B:) Troponin C {Chicken (Gallus gallus)}
qqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieev
dedgsgtidfeeflvmmvrqmk

Timeline for d1avsb_:

• d1avsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1avsb_ appears in SCOP 1.61
  
• d1avsb_ appears in SCOP 1.65
  
• d1avsb_ appears in the current release, SCOPe 2.08