Lineage for d1avsb_ (1avs B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3402Protein Troponin C [47503] (5 species)
  7. 3403Species Chicken (Gallus gallus) [TaxId:9031] [47504] (21 PDB entries)
  8. 3409Domain d1avsb_: 1avs B: [17227]

Details for d1avsb_

PDB Entry: 1avs (more details), 1.75 Å

PDB Description: x-ray crystallographic study of calcium-saturated n-terminal domain of troponin c

SCOP Domain Sequences for d1avsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avsb_ a.39.1.5 (B:) Troponin C {Chicken (Gallus gallus)}
qqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieev
dedgsgtidfeeflvmmvrqmk

SCOP Domain Coordinates for d1avsb_:

Click to download the PDB-style file with coordinates for d1avsb_.
(The format of our PDB-style files is described here.)

Timeline for d1avsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1avsa_