Lineage for d2zzpb_ (2zzp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932757Protein automated matches [190358] (6 species)
    not a true protein
  7. 2932847Species Norway rat (Rattus norvegicus) [TaxId:10116] [187189] (3 PDB entries)
  8. 2932850Domain d2zzpb_: 2zzp B: [171616]
    Other proteins in same PDB: d2zzpa_
    automated match to d1v49a_

Details for d2zzpb_

PDB Entry: 2zzp (more details), 2.05 Å

PDB Description: the crystal structure of human atg4b(c74s)- lc3(1-124) complex
PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d2zzpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zzpb_ d.15.1.3 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
ikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfgta

SCOPe Domain Coordinates for d2zzpb_:

Click to download the PDB-style file with coordinates for d2zzpb_.
(The format of our PDB-style files is described here.)

Timeline for d2zzpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zzpa_