Lineage for d2zzpa_ (2zzp A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155379Family d.3.1.22: Autophagin-like [159858] (3 protein domains)
    Pfam PF03416
  6. 2155391Protein automated matches [190846] (1 species)
    not a true protein
  7. 2155392Species Human (Homo sapiens) [TaxId:9606] [188165] (3 PDB entries)
  8. 2155395Domain d2zzpa_: 2zzp A: [171615]
    Other proteins in same PDB: d2zzpb_
    automated match to d2z0da1

Details for d2zzpa_

PDB Entry: 2zzp (more details), 2.05 Å

PDB Description: The crystal structure of human Atg4B(C74S)- LC3(1-124) complex
PDB Compounds: (A:) Cysteine protease ATG4B

SCOPe Domain Sequences for d2zzpa_:

Sequence, based on SEQRES records: (download)

>d2zzpa_ d.3.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggtg
ptsdtgwgsmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyysi
hqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcrt
svpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdineayvetlkh
cfmmpqslgviggkpnsahyfigyvgeeliyldphttqpaveptdgcfipdesfhcqhpp
crmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveq

Sequence, based on observed residues (ATOM records): (download)

>d2zzpa_ d.3.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggtg
ptsdtgwgsmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyysi
hqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcrt
spwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvgeeliy
ldphttqpavepipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkklsl
lalpmfelveq

SCOPe Domain Coordinates for d2zzpa_:

Click to download the PDB-style file with coordinates for d2zzpa_.
(The format of our PDB-style files is described here.)

Timeline for d2zzpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zzpb_