![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
![]() | Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117820] (1 PDB entry) Uniprot Q9GZQ8 |
![]() | Domain d1v49a_: 1v49 A: [113525] |
PDB Entry: 1v49 (more details)
SCOPe Domain Sequences for d1v49a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v49a_ d.15.1.3 (A:) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} mpsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnm selikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasqetfg
Timeline for d1v49a_: