![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
![]() | Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) ![]() dimer of two identical helix-loop-helix subunits |
![]() | Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins) |
![]() | Protein SREBP-1a [47470] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47471] (1 PDB entry) |
![]() | Domain d1am9c_: 1am9 C: [17142] protein/DNA complex; complexed with mg |
PDB Entry: 1am9 (more details), 2.3 Å
SCOPe Domain Sequences for d1am9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1am9c_ a.38.1.1 (C:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq klkqenlslrtavhkskslkdl
Timeline for d1am9c_: