PDB entry 1am9

View 1am9 on RCSB PDB site
Description: human srebp-1a bound to ldl receptor promoter
Class: transcription/DNA
Keywords: sterol regulatory element binding protein, basic-helix-loop-helix-leucine zipper, srebp, transcription factor, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1997-06-25, released 1998-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sterol regulatory element binding protein 1a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1am9a_
  • Chain 'B':
    Compound: protein (sterol regulatory element binding protein 1a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1am9b_
  • Chain 'C':
    Compound: protein (sterol regulatory element binding protein 1a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1am9c_
  • Chain 'D':
    Compound: protein (sterol regulatory element binding protein 1a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1am9d_
  • Chain 'E':
    Compound: DNA (5'-d(*tp*tp*gp*cp*ap*gp*tp*gp*gp*gp*gp*tp*gp*ap*tp*cp*t )-3')
  • Chain 'F':
    Compound: DNA (5'-d(*cp*ap*tp*gp*ap*gp*ap*tp*cp*ap*cp*cp*cp*cp*ap*cp*t p*gp*cp*ap*a)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*tp*tp*gp*cp*ap*gp*tp*gp*gp*gp*gp*tp*gp*ap*tp*cp*t )-3')
  • Chain 'H':
    Compound: DNA (5'-d(*cp*ap*tp*gp*ap*gp*ap*tp*cp*ap*cp*cp*cp*cp*ap*cp*t p*gp*cp*ap*a)-3')
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1am9A (A:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am9A (A:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1am9B (B:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am9B (B:)
    srgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnqk
    lkqenlslrtavhks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1am9C (C:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1am9D (D:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhkskslkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1am9D (D:)
    qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
    klkqenlslrtavhks
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.