Lineage for d1am9d_ (1am9 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709988Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2709989Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2709990Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)
  6. 2710021Protein SREBP-1a [47470] (1 species)
  7. 2710022Species Human (Homo sapiens) [TaxId:9606] [47471] (1 PDB entry)
  8. 2710026Domain d1am9d_: 1am9 D: [17143]
    protein/DNA complex; complexed with mg

Details for d1am9d_

PDB Entry: 1am9 (more details), 2.3 Å

PDB Description: human srebp-1a bound to ldl receptor promoter
PDB Compounds: (D:) protein (sterol regulatory element binding protein 1a)

SCOPe Domain Sequences for d1am9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1am9d_ a.38.1.1 (D:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]}
qsrgekrtahnaiekryrssindkiielkdlvvgteaklnksavlrkaidyirflqhsnq
klkqenlslrtavhks

SCOPe Domain Coordinates for d1am9d_:

Click to download the PDB-style file with coordinates for d1am9d_.
(The format of our PDB-style files is described here.)

Timeline for d1am9d_: