| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) ![]() dimer of two identical helix-loop-helix subunits |
| Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins) |
| Protein Max protein [47461] (2 species) BHLHZ region; contains leucine-zipper motif |
| Species Human (Homo sapiens) [TaxId:9606] [47462] (3 PDB entries) |
| Domain d1hlob_: 1hlo B: [17129] protein/DNA complex |
PDB Entry: 1hlo (more details), 2.8 Å
SCOP Domain Sequences for d1hlob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlob_ a.38.1.1 (B:) Max protein {Human (Homo sapiens)}
sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh
thqqdiddlkrqn
Timeline for d1hlob_: