Lineage for d1hlob_ (1hlo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709988Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2709989Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2709990Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)
  6. 2709995Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 2709996Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)
  8. 2710002Domain d1hlob_: 1hlo B: [17129]
    protein/DNA complex

Details for d1hlob_

PDB Entry: 1hlo (more details), 2.8 Å

PDB Description: the crystal structure of an intact human max-dna complex: new insights into mechanisms of transcriptional control
PDB Compounds: (B:) protein (transcription factor max)

SCOPe Domain Sequences for d1hlob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlob_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]}
sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh
thqqdiddlkrqn

SCOPe Domain Coordinates for d1hlob_:

Click to download the PDB-style file with coordinates for d1hlob_.
(The format of our PDB-style files is described here.)

Timeline for d1hlob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hloa_