Lineage for d1hlob_ (1hlo B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152399Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
  4. 152400Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) (S)
  5. 152401Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (5 proteins)
  6. 152402Protein Max protein [47461] (2 species)
  7. 152403Species Human (Homo sapiens) [TaxId:9606] [47462] (1 PDB entry)
  8. 152405Domain d1hlob_: 1hlo B: [17129]

Details for d1hlob_

PDB Entry: 1hlo (more details), 2.8 Å

PDB Description: the crystal structure of an intact human max-dna complex: new insights into mechanisms of transcriptional control

SCOP Domain Sequences for d1hlob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlob_ a.38.1.1 (B:) Max protein {Human (Homo sapiens)}
sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh
thqqdiddlkrqn

SCOP Domain Coordinates for d1hlob_:

Click to download the PDB-style file with coordinates for d1hlob_.
(The format of our PDB-style files is described here.)

Timeline for d1hlob_:

152405
d1hlob_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1hloa_