SCOP 1.65: Domain d1hlob_: 1hlo B:

Lineage for d1hlob_ (1hlo B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)

6. Protein Max protein [47461] (2 species)
   BHLHZ region; contains leucine-zipper motif

7. Species Human (Homo sapiens) [TaxId:9606] [47462] (3 PDB entries)

8. Domain d1hlob_: 1hlo B: [17129]
   protein/DNA complex

Details for d1hlob_

PDB Entry: 1hlo, 2.8 Å

PDB Description: the crystal structure of an intact human max-dna complex: new insights into mechanisms of transcriptional control

SCOP Domain Sequences for d1hlob_:

Sequence; same for both SEQRES and ATOM records:

>d1hlob_ a.38.1.1 (B:) Max protein {Human (Homo sapiens)}
sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh
thqqdiddlkrqn

Timeline for d1hlob_:

• d1hlob_ first appeared (with stable ids) in SCOP 1.55
  
• d1hlob_ appears in SCOP 1.63
  
• d1hlob_ appears in SCOP 1.67
  
• d1hlob_ appears in the current release, SCOPe 2.08