SCOPe 2.07: Domain d2y8qa1: 2y8q A:396-544

Lineage for d2y8qa1 (2y8q A:396-544)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.6: KA1-like [103243] (3 families)
   contains a single copy of this fold

5. Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
   PfamB PB166430

6. Protein automated matches [190788] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)

8. Domain d2y8qa1: 2y8q A:396-544 [170699]
   Other proteins in same PDB: d2y8qa2, d2y8qa3, d2y8qb_, d2y8qe1, d2y8qe2
   automated match to d2v8qa1
   complexed with adp, amp

Details for d2y8qa1

PDB Entry: 2y8q, 2.8 Å

PDB Description: Structure of the regulatory fragment of mammalian AMPK in complex with one ADP

PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2y8qa1:

Sequence, based on SEQRES records:

>d2y8qa1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltssvt
sldsspvdvaprpgshtieffemcanlik

Sequence, based on observed residues (ATOM records):

>d2y8qa1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddevaprpgshtieffemcanlik

Timeline for d2y8qa1:

• d2y8qa1 first appeared in SCOPe 2.01, called d2y8qa_
  
• d2y8qa1 appears in SCOPe 2.06
  
• d2y8qa1 appears in the current release, SCOPe 2.08