Lineage for d2y8qa_ (2y8q A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040830Superfamily d.129.6: KA1-like [103243] (2 families) (S)
    contains a single copy of this fold
  5. 1040839Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 1040861Protein automated matches [190788] (2 species)
    not a true protein
  7. 1040862Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)
  8. 1040867Domain d2y8qa_: 2y8q A: [170699]
    Other proteins in same PDB: d2y8qb_
    automated match to d2v8qa1
    complexed with adp, amp

Details for d2y8qa_

PDB Entry: 2y8q (more details), 2.8 Å

PDB Description: Structure of the regulatory fragment of mammalian AMPK in complex with one ADP
PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2y8qa_:

Sequence, based on SEQRES records: (download)

>d2y8qa_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly
qvdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevslts
svtsldsspvdvaprpgshtieffemcanliknsctvn

Sequence, based on observed residues (ATOM records): (download)

>d2y8qa_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly
qvdsrtylldfrsiddevaprpgshtieffemcanliknsctvn

SCOPe Domain Coordinates for d2y8qa_:

Click to download the PDB-style file with coordinates for d2y8qa_.
(The format of our PDB-style files is described here.)

Timeline for d2y8qa_: