Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
Superfamily d.353.1: AMPKBI-like [160219] (1 family) |
Family d.353.1.1: AMPKBI-like [160220] (4 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
Protein automated matches [190789] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188044] (5 PDB entries) |
Domain d2y8qb_: 2y8q B: [170700] Other proteins in same PDB: d2y8qa_ automated match to d2v8qb1 complexed with adp, amp |
PDB Entry: 2y8q (more details), 2.8 Å
SCOPe Domain Sequences for d2y8qb_:
Sequence, based on SEQRES records: (download)
>d2y8qb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds vmvlsathrykkkyvttllykpi
>d2y8qb_ d.353.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqemyafrseerfksppilpphllqvilnkdpnhvmlnhlyalsikdsvmvlsathrykk kyvttllykpi
Timeline for d2y8qb_: