Lineage for d2y8qa1 (2y8q A:396-544)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976205Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2976214Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 2976236Protein automated matches [190788] (2 species)
    not a true protein
  7. 2976241Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)
  8. 2976245Domain d2y8qa1: 2y8q A:396-544 [170699]
    Other proteins in same PDB: d2y8qa2, d2y8qa3, d2y8qb_, d2y8qe1, d2y8qe2
    automated match to d2v8qa1
    complexed with adp, amp

Details for d2y8qa1

PDB Entry: 2y8q (more details), 2.8 Å

PDB Description: Structure of the regulatory fragment of mammalian AMPK in complex with one ADP
PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2y8qa1:

Sequence, based on SEQRES records: (download)

>d2y8qa1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltssvt
sldsspvdvaprpgshtieffemcanlik

Sequence, based on observed residues (ATOM records): (download)

>d2y8qa1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddevaprpgshtieffemcanlik

SCOPe Domain Coordinates for d2y8qa1:

Click to download the PDB-style file with coordinates for d2y8qa1.
(The format of our PDB-style files is described here.)

Timeline for d2y8qa1: