| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.6: KA1-like [103243] (3 families) ![]() contains a single copy of this fold |
| Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins) PfamB PB166430 |
| Protein automated matches [190788] (2 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries) |
| Domain d2y8qa1: 2y8q A:396-544 [170699] Other proteins in same PDB: d2y8qa2, d2y8qa3, d2y8qb_, d2y8qe1, d2y8qe2 automated match to d2v8qa1 complexed with adp, amp |
PDB Entry: 2y8q (more details), 2.8 Å
SCOPe Domain Sequences for d2y8qa1:
Sequence, based on SEQRES records: (download)
>d2y8qa1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltssvt
sldsspvdvaprpgshtieffemcanlik
>d2y8qa1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddevaprpgshtieffemcanlik
Timeline for d2y8qa1: