Lineage for d6croa_ (6cro A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709338Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2709358Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 2709359Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)
  8. 2709368Domain d6croa_: 6cro A: [17047]
    protein/DNA complex; complexed with so4
    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d6croa_

PDB Entry: 6cro (more details), 3 Å

PDB Description: crystal structure of lambda-cro bound to a consensus operator at 3.0 angstrom resolution
PDB Compounds: (A:) lambda cro repressor

SCOPe Domain Sequences for d6croa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6croa_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsn

SCOPe Domain Coordinates for d6croa_:

Click to download the PDB-style file with coordinates for d6croa_.
(The format of our PDB-style files is described here.)

Timeline for d6croa_: