PDB entry 6cro

View 6cro on RCSB PDB site
Description: crystal structure of lambda-cro bound to a consensus operator at 3.0 angstrom resolution
Class: gene regulation/DNA
Keywords: complex (transcription regulation-DNA), cro, bacteriophage lambda, conformational change, repressor, helix-turn-helix, gene regulation-DNA complex
Deposited on 1998-04-22, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda cro repressor
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6croa_
  • Chain 'R':
    Compound: DNA (5'-d(*ap*cp*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*ap*c)-3')
  • Chain 'U':
    Compound: DNA (5'-d(*tp*gp*tp*ap*tp*cp*ap*cp*cp*cp*gp*cp*gp*gp*tp*gp*ap*tp*ap*g)-3')
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6croA (A:)
    eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsn
    

  • Chain 'R':
    No sequence available.

  • Chain 'U':
    No sequence available.