![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [189614] (1 PDB entry) |
![]() | Domain d2xigb_: 2xig B: [170115] automated match to d1mzba_ complexed with cit, zn |
PDB Entry: 2xig (more details), 1.85 Å
SCOPe Domain Sequences for d2xigb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xigb_ a.4.5.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq nevvkkyqaklishdmkmfvwckecqes
Timeline for d2xigb_: