Lineage for d2xiga_ (2xig A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694779Species Helicobacter pylori [TaxId:85962] [189614] (1 PDB entry)
  8. 2694780Domain d2xiga_: 2xig A: [170114]
    automated match to d1mzba_
    complexed with cit, zn

Details for d2xiga_

PDB Entry: 2xig (more details), 1.85 Å

PDB Description: the structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d2xiga_:

Sequence, based on SEQRES records: (download)

>d2xiga_ a.4.5.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts
issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq
nevvkkyqaklishdmkmfvwckecqes

Sequence, based on observed residues (ATOM records): (download)

>d2xiga_ a.4.5.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mkrletlesilerlrmsikkngnskqreevvsvlyrsgthlspeeithsirqkdkntsis
svyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrqne
vvkkyqaklishdmkmfvwckecqes

SCOPe Domain Coordinates for d2xiga_:

Click to download the PDB-style file with coordinates for d2xiga_.
(The format of our PDB-style files is described here.)

Timeline for d2xiga_: